DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and prdx-3

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_497892.1 Gene:prdx-3 / 175573 WormBaseID:WBGene00011110 Length:226 Species:Caenorhabditis elegans


Alignment Length:182 Identity:115/182 - (63%)
Similarity:142/182 - (78%) Gaps:0/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCST 73
            |||.|||||:|.||.|...|||||:||:|||||||||||||||||:.:.|.|||.:..||:.||.
 Worm    40 PAFKGTAVVDGDFKVISDQDYKGKWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACSC 104

  Fly    74 DSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQIT 138
            ||.|:||||:|||||.||||.||||||||.:.|:|..:||||:|:|:.:||||:||....:|..|
 Worm   105 DSHFSHLAWVNTPRKDGGLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLIDPSGTVRHTT 169

  Fly   139 VNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190
            .|||||||||:||||:::|||::||:||||||:|.....|:......|||||
 Worm   170 CNDLPVGRSVDETLRVLKAFQFSDKHGEVCPADWHEDSPTIKPGVATSKEYF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 109/165 (66%)
prdx-3NP_497892.1 PRX_Typ2cys 37..206 CDD:239313 109/165 (66%)
AhpC 38..223 CDD:223527 115/182 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167756
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.660

Return to query results.
Submit another query.