DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and Prdx1

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_476455.1 Gene:Prdx1 / 117254 RGDID:620039 Length:199 Species:Rattus norvegicus


Alignment Length:185 Identity:134/185 - (72%)
Similarity:154/185 - (83%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PAPAFAGTAVV-NGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIG 70
            |||:|..|||: :|.||||.||||||||:|.|||||||||||||||||||:.|.||:|:||:|||
  Rat    11 PAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIG 75

  Fly    71 CSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLR 135
            .|.||.|.||||||||:||||||.|:|||::|....:|:|||||..:.||.||||||||||..||
  Rat    76 ASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR 140

  Fly   136 QITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190
            |||:|||||||||:|.||||||||:|||:||||||.||||..|:..|..||||||
  Rat   141 QITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 124/168 (74%)
Prdx1NP_476455.1 PRX_Typ2cys 8..180 CDD:239313 124/168 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 201 1.000 Domainoid score I2914
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 283 1.000 Inparanoid score I2793
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm45874
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR10681
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.