Sequence 1: | NP_001261350.1 | Gene: | Jafrac2 / 53577 | FlyBaseID: | FBgn0040308 | Length: | 242 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004896.1 | Gene: | PRDX6 / 9588 | HGNCID: | 16753 | Length: | 224 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 55/200 - (27%) |
---|---|---|---|
Similarity: | 90/200 - (45%) | Gaps: | 21/200 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 APQFEGTAVVNKEIVKLSLSQYLG-KYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGV 119
Fly 120 SVDSHFTHLAW---INTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGL-------F 174
Fly 175 IIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNP----EEKT 235
Fly 236 KYFAK 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jafrac2 | NP_001261350.1 | PRX_Typ2cys | 52..223 | CDD:239313 | 47/177 (27%) |
PRDX6 | NP_004896.1 | PRX_1cys | 7..222 | CDD:239314 | 54/199 (27%) |
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000250|UniProtKB:O35244 | 31..40 | 1/8 (13%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0450 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100111 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.710 |