DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and PRDX6

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_004896.1 Gene:PRDX6 / 9588 HGNCID:16753 Length:224 Species:Homo sapiens


Alignment Length:200 Identity:55/200 - (27%)
Similarity:90/200 - (45%) Gaps:21/200 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 APQFEGTAVVNKEIVKLSLSQYLG-KYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGV 119
            ||.||    .|..:.::....:|| .:.:|..:|.|||.||.||:...:....||.|...::|.:
Human    11 APNFE----ANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIAL 71

  Fly   120 SVDSHFTHLAW---INTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGL-------F 174
            |:||...||||   ||....|.....:..|::.|...:::...|: |:.:....:|:       |
Human    72 SIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGM-LDPAEKDEKGMPVTARVVF 135

  Fly   175 IIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNP----EEKT 235
            :......|:...:.....||:.||.:|:|.:.|.|.......|..|:.| |:::..|    ||..
Human   136 VFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDG-DSVMVLPTIPEEEAK 199

  Fly   236 KYFAK 240
            |.|.|
Human   200 KLFPK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 47/177 (27%)
PRDX6NP_004896.1 PRX_1cys 7..222 CDD:239314 54/199 (27%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000250|UniProtKB:O35244 31..40 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.