DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and Prdx6

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_446028.1 Gene:Prdx6 / 94167 RGDID:71005 Length:224 Species:Rattus norvegicus


Alignment Length:202 Identity:55/202 - (27%)
Similarity:87/202 - (43%) Gaps:24/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VISKPAPQFEGTAVVNKEIVKLSLSQYLG-KYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKT 114
            ::...||.||    .|..|..:....:|| .:.:|..:|.|||.||.||:...:....||.|...
  Rat     6 LLGDEAPNFE----ANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNV 66

  Fly   115 EVIGVSVDSHFTHLAW---INTPRKEGGLGDVKIPLLSDLTHKISKDYGVYL--------ESSGH 168
            ::|.:|:||...|.||   ||..........:..|::.|.    .:|..:.|        :..|.
  Rat    67 KLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDK----DRDLAILLGMLDPAEKDEKGM 127

  Fly   169 AL--RGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIV-PN 230
            .:  |.:||......|:...:.....||:.||.:|:|.:.|.|.::....|..|:.|...:| |.
  Rat   128 PVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVDWKKGESVMVLPT 192

  Fly   231 -PEEKTK 236
             |||:.|
  Rat   193 LPEEEAK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 48/184 (26%)
Prdx6NP_446028.1 AhpC 5..200 CDD:223527 55/202 (27%)
PRX_1cys 7..222 CDD:239314 55/201 (27%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000269|PubMed:19700648 31..40 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.