DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and Prdx4

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_017457660.1 Gene:Prdx4 / 85274 RGDID:620043 Length:282 Species:Rattus norvegicus


Alignment Length:227 Identity:149/227 - (65%)
Similarity:171/227 - (75%) Gaps:11/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSVLLLSAALVGAA-----KPEDNESCYSFAGGSVYPDQPK----GDHQLQYTKAVISKPAPQFE 60
            |..||.:.||.|..     :..:|| |:.:|||.|||.:..    .||.|..:||.||||||.:|
  Rat    36 LLFLLQTEALQGLESDDRFRTRENE-CHFYAGGQVYPGEVSRVSVADHSLHLSKAKISKPAPYWE 99

  Fly    61 GTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHF 125
            ||||:|.|..:|.|:.|.|||:|..|||||||||||||||||.|||.|||.|.|||:..||||.|
  Rat   100 GTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQF 164

  Fly   126 THLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGVLRQITMNDL 190
            ||||||||||::||||.::|||||||.|:||||||||||.|||.||||||||..|||||||:|||
  Rat   165 THLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDL 229

  Fly   191 PVGRSVDETIRLVQAFQYTDTHGEVCP-AGWR 221
            |||||||||:||||||||||.|||..| :.|:
  Rat   230 PVGRSVDETLRLVQAFQYTDKHGEDNPRSSWK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 129/171 (75%)
Prdx4XP_017457660.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354376
Domainoid 1 1.000 209 1.000 Domainoid score I2745
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4672
Inparanoid 1 1.050 331 1.000 Inparanoid score I2357
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - oto96959
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR10681
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.