DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and PRX1

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_009489.1 Gene:PRX1 / 852215 SGDID:S000000160 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:66/215 - (30%)
Similarity:103/215 - (47%) Gaps:28/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DQPKGDHQLQYTKAVISKPAPQFEGTAVVNKEIVKLSLSQYLG-KYVVLLFYPLDFTFVCPTEII 100
            |||         :..|:..||.|:....|.    |::...||| .:.||..:|.|||.||.||:.
Yeast    45 DQP---------RLRINSDAPNFDADTTVG----KINFYDYLGDSWGVLFSHPADFTPVCTTEVS 96

  Fly   101 AFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLES 165
            ||:....||.|...::||:||:...:|..||...::...:.:|..|::.|....::..|.: :::
Yeast    97 AFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDM-VDA 160

  Fly   166 SG---------HALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWR 221
            .|         ..:|.:|:||....:|.|......|||:..|.:|::.|.|.||..|.|.|..|:
Yeast   161 EGFKNINDGSLKTVRSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQ 225

  Fly   222 PGADTIVP----NPEEKTKY 237
            |..|.|:|    |.|.|.|:
Yeast   226 PADDVIIPPSVSNDEAKAKF 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 55/180 (31%)
PRX1NP_009489.1 PRX_1cys 51..259 CDD:239314 63/200 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.