DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and PRXQ

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001189979.1 Gene:PRXQ / 822203 AraportID:AT3G26060 Length:217 Species:Arabidopsis thaliana


Alignment Length:138 Identity:52/138 - (37%)
Similarity:77/138 - (55%) Gaps:14/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRK 136
            :||.:|.||.|||.|||.|.|..|..:..||.|...:|||...||||:|.|...:|.|:.:    
plant    89 VSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFAS---- 149

  Fly   137 EGGLGDVKIP--LLSDLTHKISKDYGVYLESSGHALRG--LFIIDQTGVLRQITMNDLPVGRSVD 197
                 ..|:|  ||||..:|:.||:||..:..| ||.|  .:::|:.||::.|..|.....:.:|
plant   150 -----KYKLPYTLLSDEGNKVRKDWGVPGDLFG-ALPGRQTYVLDKNGVVQLIYNNQFQPEKHID 208

  Fly   198 ETIRLVQA 205
            ||::.::|
plant   209 ETLKFLKA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 52/138 (38%)
PRXQNP_001189979.1 PRX_BCP 74..212 CDD:239315 51/132 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.