DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and prdx3

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001025608.1 Gene:prdx3 / 594996 XenbaseID:XB-GENE-994377 Length:243 Species:Xenopus tropicalis


Alignment Length:204 Identity:124/204 - (60%)
Similarity:156/204 - (76%) Gaps:6/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HQLQYTKA------VISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIA 101
            |:||::.:      .:::.||.|:||||||.|..:|||..|.|||:||.||||||||||||||:|
 Frog    38 HKLQFSTSSVRFLPAVTQHAPHFKGTAVVNGEFKELSLEDYKGKYLVLFFYPLDFTFVCPTEIVA 102

  Fly   102 FSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESS 166
            ||::..||..:..||:.|||||||.||||.|||||.||||.:.|||||||..:||:||||.||:.
 Frog   103 FSNKANEFHDVNCEVVAVSVDSHFCHLAWTNTPRKSGGLGQMNIPLLSDLNKQISRDYGVLLETP 167

  Fly   167 GHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNP 231
            |.|||||||||..|:::.:::|||||||||:||:|||:|||:.:||||||||.|.|.:.||.|:|
 Frog   168 GIALRGLFIIDPNGIIKHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPDSPTIKPSP 232

  Fly   232 EEKTKYFAK 240
            |....||.|
 Frog   233 EGSKDYFEK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 112/170 (66%)
prdx3NP_001025608.1 PRX_Typ2cys 53..224 CDD:239313 112/170 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.