DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and Jafrac1

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster


Alignment Length:187 Identity:124/187 - (66%)
Similarity:146/187 - (78%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEV 116
            :.||||.|.||||||.....:.||.|.|||:||.||||||||||||||||||:..|||:||..||
  Fly     4 LQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEV 68

  Fly   117 IGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGV 181
            ||.|.||.||||||||||||:||||.:.||||:|.:.|:::||||..|.:|...|||||||....
  Fly    69 IGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQN 133

  Fly   182 LRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYF 238
            |||||:|||||||||:||:||||||||||.:||||||.|:||..|:|.:|.:..:||
  Fly   134 LRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 117/170 (69%)
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 117/170 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473001
Domainoid 1 1.000 99 1.000 Domainoid score I358
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I1131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113940at50557
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm51377
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - P PTHR10681
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
1110.800

Return to query results.
Submit another query.