DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and prdx6

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_957099.1 Gene:prdx6 / 393778 ZFINID:ZDB-GENE-040426-1778 Length:222 Species:Danio rerio


Alignment Length:195 Identity:53/195 - (27%)
Similarity:90/195 - (46%) Gaps:17/195 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PQFEGTAVVNKEIVKLSLSQYLG-KYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVS 120
            |.||....:.    |:...::|| .:.:|..:|.|||.||.||:...:....||||...::|.:|
Zfish    11 PNFEADTTIG----KIKFHEFLGNSWGILFSHPRDFTPVCTTELARAAKLHEEFKKRDVKMIALS 71

  Fly   121 VDSHFTHLAW---INTPRKEGGLGDVKIPLLSDLTHKISKDYGVY----LESSGHAL--RGLFII 176
            :||...|..|   |....::.....:..|:::|...::|...|:.    .:..|..|  |.:|::
Zfish    72 IDSVEDHRKWSEDILAFNQDKACCPMPFPIIADDKRELSVLLGMLDPDERDKDGMPLTARCVFVV 136

  Fly   177 DQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADT-IVP--NPEEKTKYF 238
            .....|:...:.....||:.||.:|:|.:.|.|.|.....|..|:||.:. ::|  :.||..|.|
Zfish   137 GPDKRLKLSILYPATTGRNFDEILRVVDSLQLTATKKVATPVDWKPGQEVMVIPSLSDEEANKLF 201

  Fly   239  238
            Zfish   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 46/175 (26%)
prdx6NP_957099.1 AhpC 5..199 CDD:223527 51/191 (27%)
PRX_1cys 6..221 CDD:239314 53/195 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.