DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and Prx6005

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster


Alignment Length:154 Identity:43/154 - (27%)
Similarity:75/154 - (48%) Gaps:6/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 YVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKI 145
            :.:|..:|.|||.||.||:...:..|.||:|...:.|.:|.|:..:|..||...:..|.|.....
  Fly    34 WAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPIALSCDTVESHKGWIEDIKSFGKLSSFDY 98

  Fly   146 PLLSDLTHKISKDYGVY----LESSGHAL--RGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQ 204
            |:::|...:::..:.:.    :.:.|..|  |.:|::|....||...:.....||:.||.:|::.
  Fly    99 PIIADDKRELALKFNMLDKDEINAEGIPLTCRAVFVVDDKKKLRLSILYPATTGRNFDEILRVID 163

  Fly   205 AFQYTDTHGEVCPAGWRPGADTIV 228
            :.|.|.|.....||.|:.|...:|
  Fly   164 SLQLTQTKSVATPADWKQGGKCMV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 41/147 (28%)
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 43/154 (28%)
AhpC 8..198 CDD:223527 43/154 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.