DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and tpx1

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_588430.1 Gene:tpx1 / 2539572 PomBaseID:SPCC576.03c Length:192 Species:Schizosaccharomyces pombe


Alignment Length:191 Identity:118/191 - (61%)
Similarity:148/191 - (77%) Gaps:4/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEV 116
            |.||||.|:||||||....::.|:.|.||:|.|.||||||||||||||:|||:..::|.:...:|
pombe     5 IGKPAPDFKGTAVVNGAFEEIKLADYKGKWVFLGFYPLDFTFVCPTEIVAFSEAASKFAERNAQV 69

  Fly   117 IGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGV 181
            |..|.||.::|||:|||||||||||.:.||||:|.:||:|:||||.:|.:|.|.||||:||..||
pombe    70 ILTSTDSEYSHLAFINTPRKEGGLGGINIPLLADPSHKVSRDYGVLIEDAGVAFRGLFLIDPKGV 134

  Fly   182 LRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTI-VPNPEEKTKYFAKN 241
            |||||:|||||||||||.:||:.|||:.:.|||||||.|..|:||| ..|||   |||:|:
pombe   135 LRQITINDLPVGRSVDEALRLLDAFQFVEEHGEVCPANWHKGSDTIDTKNPE---KYFSKH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 107/170 (63%)
tpx1NP_588430.1 AhpC 1..192 CDD:223527 117/189 (62%)
PRX_Typ2cys 5..176 CDD:239313 107/170 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm47233
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - O PTHR10681
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.