DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and Prdx1

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_476455.1 Gene:Prdx1 / 117254 RGDID:620039 Length:199 Species:Rattus norvegicus


Alignment Length:192 Identity:126/192 - (65%)
Similarity:150/192 - (78%) Gaps:1/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AVISKPAPQFEGTAVV-NKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIK 113
            |.|..|||.|:.|||: :.:...:|||.|.|||||..||||||||||||||||||||..||||:.
  Rat     6 AKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN 70

  Fly   114 TEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQ 178
            .:|||.||||||.||||||||:|:||||.:.|||:||....|::||||.....|.:.|||||||.
  Rat    71 CQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDD 135

  Fly   179 TGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAK 240
            .|:|||||:|||||||||||.:|||||||:||.|||||||||:||:|||.|:..:..:||:|
  Rat   136 KGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 116/171 (68%)
Prdx1NP_476455.1 PRX_Typ2cys 8..180 CDD:239313 116/171 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.