DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac2 and PRDX4

DIOPT Version :9

Sequence 1:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_006397.1 Gene:PRDX4 / 10549 HGNCID:17169 Length:271 Species:Homo sapiens


Alignment Length:247 Identity:161/247 - (65%)
Similarity:190/247 - (76%) Gaps:9/247 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSVLLLSAALVGAAKPED-----NESCYSFAGGSVYPDQPK----GDHQLQYTKAVISKPAPQFE 60
            |.:.||.|..|...:.|:     .|.|:.:|||.|||.:..    .||.|..:||.||||||.:|
Human    25 LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWE 89

  Fly    61 GTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHF 125
            ||||::.|..:|.|:.|.|||:|..|||||||||||||||||.||:.||:.|.|||:..||||.|
Human    90 GTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQF 154

  Fly   126 THLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGVLRQITMNDL 190
            ||||||||||::||||.::|||||||||:||||||||||.|||.||||||||..|:|||||:|||
Human   155 THLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDL 219

  Fly   191 PVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAKNN 242
            |||||||||:||||||||||.|||||||||:||::||:|:|..|.|||.|.|
Human   220 PVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 130/170 (76%)
PRDX4NP_006397.1 PRX_Typ2cys 81..252 CDD:239313 130/170 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160322
Domainoid 1 1.000 207 1.000 Domainoid score I2899
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4672
Inparanoid 1 1.050 331 1.000 Inparanoid score I2447
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - oto89843
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR10681
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9109
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.