DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and YGL242C

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_011272.1 Gene:YGL242C / 852609 SGDID:S000003211 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:32/173 - (18%)
Similarity:58/173 - (33%) Gaps:40/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDIFHWCREGNSIQVRLWLDETEHD--------NNLGDDHGFSPLHWVAKEGHAKLVETLLQRGS 58
            |.:....|..|...:....|..::|        |...:..|.:.||...|.|..::::.:|.:..
Yeast    10 EQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCKYGSWEVLDKILDQDG 74

  Fly    59 RVNATNMGD---DIPLHLAAAHGHRDVVQMLIKERSDVNAVNEHGNTPLHYACFWGYDMICEDLL 120
            .:......|   |.|||:...:...:               .|||.            .|..:|:
Yeast    75 EIEIDPQNDVDGDTPLHVTVRYSQEE---------------PEHGT------------FIARNLI 112

  Fly   121 NAGAQVGIANKDGHTPLEKAKPSLAKRLQDLVEKSGREVKVIS 163
            ..||...:.|.:...|::.........|.||::  |.|:.:.|
Yeast   113 EVGADPRVRNYNNQKPVDLVHGDELDELIDLLQ--GAELAIDS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125 20/114 (18%)
ANK repeat 33..64 CDD:293786 6/30 (20%)
Ank_2 38..130 CDD:289560 17/94 (18%)
ANK repeat 66..97 CDD:293786 5/33 (15%)
ANK repeat 99..130 CDD:293786 6/30 (20%)
PK_ILK 196..446 CDD:270959
STYKc 204..443 CDD:214568
YGL242CNP_011272.1 Ank_2 12..122 CDD:403870 23/136 (17%)
ANK repeat 12..47 CDD:293786 5/34 (15%)
ANK repeat 49..83 CDD:293786 6/33 (18%)
ANK repeat 85..122 CDD:293786 11/63 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.