DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and AT1G72760

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001322061.1 Gene:AT1G72760 / 843608 AraportID:AT1G72760 Length:700 Species:Arabidopsis thaliana


Alignment Length:346 Identity:72/346 - (20%)
Similarity:130/346 - (37%) Gaps:73/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LAKRL-------QDLVEKSGREVKVISFKEQSWQGLKTRS-RDATLSRFKGISMGDLDLHTKLSV 200
            :|||:       :.|:|......|.:.|...|::....:. .|||......:.:|:         
plant   344 IAKRIAKMESQKRRLLEMQANLDKQMMFTTVSYRRYSIKDVEDATYGFSDALKIGE--------- 399

  Fly   201 TPSGETWRGRWQKNDVVAKILAVRQCTPRISRDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTI 265
            ...|..::.......|..|||  :.......:.|.:|...|....|||::.::|||  |.....:
plant   400 GGYGPVYKAVLDYTSVAIKIL--KSGITEGLKQFQQEIEVLSSMRHPNMVILLGAC--PEYGCLV 460

  Fly   266 SQFMPRSSLFSLLHGATGVVVDTSQA-VSFALDVARGMAFLHSLERIIPTYH--LNSHHVMIDDD 327
            .::|...:|...|.........:.:| ...|.::|.|:.|||. .:..|..|  |...::::|..
plant   461 YEYMENGTLEDRLFCKNNTPPLSWRARFRIASEIATGLLFLHQ-AKPEPLVHRDLKPANILLDKH 524

  Fly   328 LTARI-NMGDAKFSFQEKGRIYQPA------------------WMSPETLQRKQADRNWEACDMW 373
            ||.:| ::|.|        |:..||                  ::.||   .:|........|::
plant   525 LTCKISDVGLA--------RLVPPAVADTYSNYHMTSAAGTFCYIDPE---YQQTGMLGVKSDLY 578

  Fly   374 SFAILIWELTTREVPFAEWSPMECGMKIAL----EGLRVKIPPGTS-------THMAKLISICMN 427
            ||.:::.::.|.:      ..|..|.|:.:    ..||..:.|..|       ..:|||...|..
plant   579 SFGVVLLQIITAQ------PAMGLGHKVEMAVENNNLREILDPTVSEWPEEETLELAKLALQCCE 637

  Fly   428 EDPGKRPKFDMV-VPILEKMR 447
            .....||...:| :|.|.:::
plant   638 LRKKDRPDLALVLLPALNRLK 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 60/283 (21%)
STYKc 204..443 CDD:214568 59/272 (22%)
AT1G72760NP_001322061.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.