DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and AT5G50180

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_199829.1 Gene:AT5G50180 / 835083 AraportID:AT5G50180 Length:346 Species:Arabidopsis thaliana


Alignment Length:306 Identity:86/306 - (28%)
Similarity:129/306 - (42%) Gaps:63/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 EQSWQGLKTRSRDATLSRFKGISMGDLDLHTKLSVTPSGETWRGRWQKNDVVAKILAVRQCTP-- 228
            |..||      .|..| .|.|..:|: ..|.|:        :.|:: ||..||..:..|..||  
plant    10 EPKWQ------IDPQL-LFVGPKIGE-GAHAKV--------YEGKY-KNQTVAIKIVHRGETPEE 57

  Fly   229 ---RISRDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQ 290
               |.|| |..|...|....|.|::..||||..|. :|.:::.:...:|...|.......::|..
plant    58 IAKRDSR-FLREVEMLSRVQHKNLVKFIGACKEPV-MVIVTELLQGGTLRKYLLNLRPACLETRV 120

  Fly   291 AVSFALDVARGMAFLHSLERIIPTYHLNSHHVMIDDD-------LTA---RINMGDAKFSFQEKG 345
            |:.||||:||||..|||             |.:|..|       |||   .:.:.|...:.:|..
plant   121 AIGFALDIARGMECLHS-------------HGIIHRDLKPENLLLTADHKTVKLADFGLAREESL 172

  Fly   346 RIYQPA------WMSPE-----TLQRKQADRNWEACDMWSFAILIWELTTREVPFAEWSPMECGM 399
            .....|      ||:||     ||:..:........|.:||||::|||...::||...|.::...
plant   173 TEMMTAETGTYRWMAPELYSTVTLRLGEKKHYNHKVDAYSFAIVLWELLHNKLPFEGMSNLQAAY 237

  Fly   400 KIALEGLRVKIPPGTS--THMAKLISICMNEDPGKRPKFDMVVPIL 443
            ..|.:.:|   |...|  ..:..:::.|.||||..||.|..::.:|
plant   238 AAAFKNVR---PSAESLPEELGDIVTSCWNEDPNARPNFTHIIELL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 77/276 (28%)
STYKc 204..443 CDD:214568 75/266 (28%)
AT5G50180NP_199829.1 STKc_MAP3K-like 26..280 CDD:270901 78/281 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.