DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and AT4G18950

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_567568.1 Gene:AT4G18950 / 827630 AraportID:AT4G18950 Length:459 Species:Arabidopsis thaliana


Alignment Length:423 Identity:103/423 - (24%)
Similarity:188/423 - (44%) Gaps:67/423 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LHWVAKEGHAKLVETLLQRGSRVNATNMGDDIPLHLAAAHGHRDVVQMLIKERSDVNAVNEHGNT 102
            |.::|.||..:.::.|:..|...|..::.|...||:||..|.:|||::|:..:::|:..:..|:|
plant    47 LMYLANEGDIEGIKELIDSGIDANYRDIDDRTALHVAACQGLKDVVELLLDRKAEVDPKDRWGST 111

  Fly   103 PLHYACFWGYDMICEDLLNAGAQVGIANKDGHTPLEKAKPSLAKRLQDLVEKSGREVKVISFKEQ 167
            |...|.|:....:.:.|...||:..:|..  |....:..|.......:|.....:|:...::...
plant   112 PFADAIFYKNIDVIKILEIHGAKHPMAPM--HVKTAREVPEYEINPSELDFTQSKEITKGTYCMA 174

  Fly   168 SWQGLKTRSRDATLSRFKGISMGDLDLHTKLSVTPSGETWRGRWQKNDVVAKILAVRQCTPRISR 232
            .|:|::             :::..||                    ::|::....||:       
plant   175 MWRGIQ-------------VAVKKLD--------------------DEVLSDDDQVRK------- 199

  Fly   233 DFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQAVSFALD 297
             |::|...|:...||||:..:||......::.:::::||..|..||.....:...|  ||.:|||
plant   200 -FHDELALLQRLRHPNIVQFLGAVTQSNPMMIVTEYLPRGDLRELLKRKGQLKPAT--AVRYALD 261

  Fly   298 VARGMAFLHSLERIIPTYH--LNSHHVMIDDDLTARI-NMG---------DAKFSFQEKGRIYQP 350
            :||||::||.::. .|..|  |...:::.||....:: :.|         |..|:.|:....|  
plant   262 IARGMSYLHEIKG-DPIIHRDLEPSNILRDDSGHLKVADFGVSKLVTVKEDKPFTCQDISCRY-- 323

  Fly   351 AWMSPETLQRKQADRNWEACDMWSFAILIWELTTREVPFAEWSPMECGMKIALEGLRV-KIPPGT 414
              ::||....::.|..   .|::|||:::.|:....:||||....|.....|.:...: |.|...
plant   324 --IAPEVFTSEEYDTK---ADVFSFALIVQEMIEGRMPFAEKEDSEASEAYAGKHRPLFKAPSKN 383

  Fly   415 STHMAK-LISICMNEDPGKRPKFDMVVPILEKM 446
            ..|..| ||..|.:|.|.|||.|..::..||.:
plant   384 YPHGLKTLIEECWHEKPAKRPTFREIIKRLESI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125 28/101 (28%)
ANK repeat 33..64 CDD:293786 7/25 (28%)
Ank_2 38..130 CDD:289560 26/91 (29%)
ANK repeat 66..97 CDD:293786 11/30 (37%)
ANK repeat 99..130 CDD:293786 8/30 (27%)
PK_ILK 196..446 CDD:270959 68/263 (26%)
STYKc 204..443 CDD:214568 66/252 (26%)
AT4G18950NP_567568.1 ANK repeat 42..73 CDD:293786 7/25 (28%)
Ank_2 47..134 CDD:372319 25/86 (29%)
ANK repeat 75..106 CDD:293786 11/30 (37%)
ANK repeat 108..133 CDD:293786 6/24 (25%)
STKc_MAP3K-like 176..413 CDD:270901 70/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.