DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and AT3G06620

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_187314.1 Gene:AT3G06620 / 819841 AraportID:AT3G06620 Length:773 Species:Arabidopsis thaliana


Alignment Length:266 Identity:76/266 - (28%)
Similarity:134/266 - (50%) Gaps:15/266 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 DLDLHTKLSVTPSGETWRGRWQKNDVVAKILAVRQCTPRISRDFNEEFPKLRIFSHPNILPIIGA 255
            ||.:..::.....|..:.|.|..:||..|:.:.::.:..:...|.:|...::...|||:|..:||
plant   493 DLTIGEQVGQGSCGTVYHGLWFGSDVAVKVFSKQEYSAEVIESFKQEVLLMKRLRHPNVLLFMGA 557

  Fly   256 CNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQAVSFALDVARGMAFLHSLERIIPTYHLNSH 320
            ..||..|..:|:|:||.|||.||..:|. .:|..:.:..|||:||||.:||.....|....|.|.
plant   558 VTSPQRLCIVSEFLPRGSLFRLLQKSTS-KLDWRRRIHMALDIARGMNYLHHCSPPIIHRDLKSS 621

  Fly   321 HVMIDDDLTARI-NMGDAKFSFQE-------KGRIYQPAWMSPETLQRKQADRNWEACDMWSFAI 377
            ::::|.:.|.:: :.|.::...:.       ||   .|.||:||.|:.:.||   |..|::||.:
plant   622 NLLVDKNWTVKVADFGLSRIKHETYLTSKSGKG---TPQWMAPEVLRNESAD---EKSDIYSFGV 680

  Fly   378 LIWELTTREVPFAEWSPMECGMKIALEGLRVKIPPGTSTHMAKLISICMNEDPGKRPKFDMVVPI 442
            ::|||.|.::|:...:.|:....:.....|::||.........|:..|.:.|...||.|..::..
plant   681 VLWELATEKIPWETLNSMQVIGAVGFMDQRLEIPKDIDPRWISLMESCWHSDTKLRPTFQELMDK 745

  Fly   443 LEKMRR 448
            |..::|
plant   746 LRDLQR 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 73/257 (28%)
STYKc 204..443 CDD:214568 72/246 (29%)
AT3G06620NP_187314.1 PAS 103..210 CDD:395786
STKc_MAP3K-like 500..746 CDD:270901 72/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.