DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and slpr

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:279 Identity:73/279 - (26%)
Similarity:123/279 - (44%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 ISMGDLDLHTKLSVTPSG---ETWRGRWQKNDVVAKILAVRQCTPRISRDFNEEFPKLRIF---S 245
            |...:||:.   .|..||   :..||.:...:|..|| |.:.....:.|..:....:.::|   .
  Fly   124 IEYNELDIK---EVIGSGGFCKVHRGYYDGEEVAIKI-AHQTGEDDMQRMRDNVLQEAKLFWALK 184

  Fly   246 HPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQAVSFALDVARGMAFLHSLER 310
            |.||..:.|.|.: ..|..:.::....||..:|.|.    :.....|::|:.:||||.:||: |.
  Fly   185 HENIAALRGVCLN-TKLCLVMEYARGGSLNRILAGK----IPPDVLVNWAIQIARGMNYLHN-EA 243

  Fly   311 IIPTYH--LNSHHVMIDDDL--------TARI-NMGDAK--FSFQEKGRIYQPAWMSPETLQRKQ 362
            .:...|  |.|.:|:|.:.:        |.:| :.|.|:  ::.|........|||.||.:....
  Fly   244 PMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVST 308

  Fly   363 ADRNWEACDMWSFAILIWELTTREVPFAEWSPMECGMKIALEGLRVKIPPGTSTHMAKLISICMN 427
            ..:   ..|:||:.:|:|||.|.|.|:..:.|:.....:|:..|.:.||.........|:..|..
  Fly   309 YSK---FSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQ 370

  Fly   428 EDPGKRPKFDMVVPILEKM 446
            .||.|||.|..::..||.:
  Fly   371 TDPHKRPGFKEILKQLESI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 70/268 (26%)
STYKc 204..443 CDD:214568 66/257 (26%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 70/269 (26%)
STKc_MLK 134..389 CDD:270963 70/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.