DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and Takl2

DIOPT Version :10

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster


Alignment Length:261 Identity:61/261 - (23%)
Similarity:109/261 - (41%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GETWRGRWQKNDVVAKILAVRQ-CTPRISRDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQ 267
            |..:|..|:..::..|  .:|: |.   .:....|..:|...||.||:.:.|........:.:.:
  Fly    25 GSVYRAVWRNREIALK--RIREGCE---DKKIEREIYQLTKASHVNIVELYGTSRHEGCALLLME 84

  Fly   268 FMPRSSLFSLLHGATGVVVDTSQAVSFALDVARGMAFLHSLE-------RIIPTYHLNS------ 319
            |:...||.|.||..:......:.|.::|..:|:|:|:||.::       .|.|   ||:      
  Fly    85 FVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKP---LNTLLCEKG 146

  Fly   320 -------HHVMIDDDLTARINMGDAKFSFQEKGRIYQPAWMSPETLQRKQADRNWEACDMWSFAI 377
                   ...::|...:...|.|..::.             :||.||..:.|   |.||::|:||
  Fly   147 LKLKICDFGTVVDLSQSISCNAGTCRYK-------------APEVLQGNKPD---EKCDVYSWAI 195

  Fly   378 LIWELTTREVPFAEWSPM-ECGMKIALEGLRVK---IPPGTSTHMAKLISICMNEDPGKRPKFDM 438
            ..||:.:|:.||.:::.: |..|.|. ||.|..   |..|....:..|:....:.|..||...::
  Fly   196 TFWEILSRKEPFEQYNTLFELYMAIN-EGERPDLSCIMSGCPADIVALLYASWDPDISKRFSMEL 259

  Fly   439 V 439
            :
  Fly   260 I 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANKYR <1..162 CDD:440430
ANK repeat 33..64 CDD:293786
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 61/261 (23%)
Takl2NP_651090.2 Protein Kinases, catalytic domain 19..268 CDD:473864 61/261 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.