DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and ksr

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster


Alignment Length:325 Identity:71/325 - (21%)
Similarity:127/325 - (39%) Gaps:88/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 ISFKEQSWQGLKTRSRDATLSRFKGISMGDLDLHTKLSVTPSGETWRGRWQKNDVVAKILAVRQC 226
            ||.||  |.                |..|||.|..::.....|...|..|. .||..|:|     
  Fly   667 ISLKE--WD----------------IPYGDLLLLERIGQGRFGTVHRALWH-GDVAVKLL----- 707

  Fly   227 TPRISRDFNEEFPKLRIF----------SHPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGA 281
                :.|:.::...|..|          .|.|::..:|||.:||.|..::.....::|::.:|  
  Fly   708 ----NEDYLQDEHMLETFRSEVANFKNTRHENLVLFMGACMNPPYLAIVTSLCKGNTLYTYIH-- 766

  Fly   282 TGVVVDTSQAVSFALD--------VARGMAFLHSLERIIPTYH--LNSHHVMIDDDLTARINMG- 335
                   .:...||::        :|:||.:||:.|.|    |  |.:.::.|::......:.| 
  Fly   767 -------QRREKFAMNRTLLIAQQIAQGMGYLHAREII----HKDLRTKNIFIENGKVIITDFGL 820

  Fly   336 --DAKFSFQEKGRIYQPAW---MSPETLQRKQADRNWEAC-------DMWSFAILIWELTTREVP 388
              ..|..:.:.|......|   ::||.::..|.::....|       |::||..:.:||...|..
  Fly   821 FSSTKLLYCDMGLGVPHNWLCYLAPELIRALQPEKPRGECLEFTPYSDVYSFGTVWYELICGEFT 885

  Fly   389 FAEWSPMEC-------GMKIALEGLRVKIPPGTSTHMAKLISICMNEDPGKRPKFDMVVPILEKM 446
            |.: .|.|.       |||.:|..|:      :...:..|:.:|...:...||:|..::.:||.:
  Fly   886 FKD-QPAESIIWQVGRGMKQSLANLQ------SGRDVKDLLMLCWTYEKEHRPQFARLLSLLEHL 943

  Fly   447  446
              Fly   944  943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 61/289 (21%)
STYKc 204..443 CDD:214568 59/278 (21%)
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 64/296 (22%)
Pkinase_Tyr 679..940 CDD:285015 61/290 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.