DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and Takl1

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:280 Identity:70/280 - (25%)
Similarity:125/280 - (44%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 KGISMGDLDLHTK-LSVTPSGETWRGRWQKNDVVAKILAVRQCTPRISRDFNEEFPKLRIFSHPN 248
            |.:...::.|..| |.....|...:..:|..::..||....:.|  |.::...|...|....|.|
  Fly     3 KQVDFAEVKLSEKFLGAGSGGAVRKATFQNQEIAVKIFDFLEET--IKKNAEREITHLSEIDHEN 65

  Fly   249 ILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQAVSFALDVARGMAFLHSLERIIP 313
            ::.:||..::......:.:::...||.:.|:|.........|||.:||..|:.:|:||||:|  |
  Fly    66 VIRVIGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLHSLDR--P 128

  Fly   314 TYH----------LNSHHVMIDDDLTARINMGDAKFSFQEKGRIYQPAWMSPETLQRKQADRNWE 368
            ..|          .|.|..:...|.....:|.:.|...|...|     :|:||.::..:....  
  Fly   129 IVHRDIKPQNMLLYNQHEDLKICDFGLATDMSNNKTDMQGTLR-----YMAPEAIKHLKYTAK-- 186

  Fly   369 ACDMWSFAILIWELTTREVPF-------AEWSPMEC---GMKIALEGLRVKIPPGTSTHMAKLIS 423
             ||::||.|::|||.||::|:       ::::.|:.   |.|:.:|.:|...|.|    :.:|:.
  Fly   187 -CDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSDCPEG----IKQLME 246

  Fly   424 ICMNEDPGKRPKFDMVVPIL 443
            .||:.:|.|||....:...|
  Fly   247 CCMDINPEKRPSMKEIEKFL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 68/269 (25%)
STYKc 204..443 CDD:214568 65/258 (25%)
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 67/262 (26%)
STKc_TAK1 17..274 CDD:270960 67/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.