DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilk and ZK622.1

DIOPT Version :9

Sequence 1:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_494994.1 Gene:ZK622.1 / 191366 WormBaseID:WBGene00022780 Length:419 Species:Caenorhabditis elegans


Alignment Length:243 Identity:52/243 - (21%)
Similarity:99/243 - (40%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 TPRISRDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQA 291
            |..:..|..:|...:|.:.|||::...|.|.....::.:.:...:.:|.|.|..... .|.....
 Worm   179 TRAMIEDVCKEARIMRQYQHPNVVCFFGVCVEKEPIMLVMELASQGALDSFLKNEKN-NVSLRDK 242

  Fly   292 VSFALDVARGMAFLHS---LERIIPTYHLNSHH--VMIDD--------DLTARINMGD--AKFSF 341
            :.::.|.::|:.:||.   :.|.:...:...|.  |.|.|        ||..:..:.|  ||...
 Worm   243 LKYSFDASKGLEYLHQHGCIHRDVAARNFLMHKNVVKITDFGLSKQLSDLAHKYKLKDIQAKLPI 307

  Fly   342 QEKGRIYQPAWMSPETLQRKQADRNWEACDMWSFAILIWEL-TTREVPFAEWSPMECGMKIA--- 402
            :         |::||.:  ..|...::: |::||.||:||: ....:|:.       |||:|   
 Worm   308 R---------WLAPEVI--VTATYTFKS-DVYSFGILLWEIFMDGAIPYP-------GMKLAEVK 353

  Fly   403 ---LEGLRVKIPPGTSTHMAK-LISICMNEDPGKRPKFDMVVPILEKM 446
               ..|.|:..|......:.. :||.|..::|..|...:.:...:|.:
 Worm   354 QKVKNGYRMDAPDRMPAFVRNIMISQCWPQNPEDRGNMNEIRLAMESV 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 52/241 (22%)
STYKc 204..443 CDD:214568 51/238 (21%)
ZK622.1NP_494994.1 SH2_Fps_family 25..114 CDD:198224
TyrKc 138..398 CDD:197581 51/238 (21%)
PTKc 142..399 CDD:270623 51/239 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.