DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment pins and Pcp2

DIOPT Version :9

Sequence 1:	NP_524999.2	Gene:	pins / 53569	FlyBaseID:	FBgn0040080	Length:	658	Species:	Drosophila melanogaster
Sequence 2:	NP_001123275.1	Gene:	Pcp2 / 18545	MGIID:	97508	Length:	136	Species:	Mus musculus

Alignment Length:	155	Identity:	37/155 - (23%)
Similarity:	58/155 - (37%)	Gaps:	63/155 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   468 DDFFEMLSRSQSKRMDDQRCSIKVNPAGAPAVATGATRKPLVQQNSLFVDPTNLPGLKSPSSANP 532
            :.||.:|:..|..||::||||::..|                                   ..||
Mouse    24 EGFFNLLTHVQGDRMEEQRCSLQAGP-----------------------------------GQNP 53

  Fly   533 SAIGHGPLARSATTTQQPD-DDFLDMLMRCQGSRLEEQR---SELP--RPNVTMDAEAEAPPRSV 591
            .:.| ||         .|: |:.:|||:..||.|:::||   :.||  :|....|...:.|....
Mouse    54 ESQG-GP---------APEMDNLMDMLVNTQGRRMDDQRVTVNSLPGFQPIGPKDGMQKRPGTLS 108

  Fly   592 PEAAV----PGA--------PRGQT 604
            |:..:    |.|        |:.||
Mouse   109 PQPLLTPQDPAALSFRRNSSPQPQT 133

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
pins	NP_524999.2	TPR_12	78..153	CDD:290160
		TPR	83..114	CDD:197478
		TPR repeat	83..109	CDD:276809
		TPR repeat	120..150	CDD:276809
		TPR_12	121..203	CDD:290160
		TPR_12	162..250	CDD:290160
		TPR repeat	162..199	CDD:276809
		TPR	219..251	CDD:197478
		TPR repeat	219..246	CDD:276809
		TPR repeat	251..291	CDD:276809
		TPR_12	259..330	CDD:290160
		TPR repeat	296..326	CDD:276809
		TPR_12	298..370	CDD:290160
		TPR	298..330	CDD:197478
		TPR repeat	338..366	CDD:276809
		GoLoco	468..488	CDD:280368	8/19 (42%)
		GoLoco	552..573	CDD:280368	9/23 (39%)
		GoLoco	613..633	CDD:280368
Pcp2	NP_001123275.1	GoLoco	24..45	CDD:280368	9/20 (45%)
Pcp2	NP_001123275.1	GoLoco	63..85	CDD:214645	9/21 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1130
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900