DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pins and PCP2

DIOPT Version :9

Sequence 1:NP_524999.2 Gene:pins / 53569 FlyBaseID:FBgn0040080 Length:658 Species:Drosophila melanogaster
Sequence 2:XP_016881738.1 Gene:PCP2 / 126006 HGNCID:30209 Length:252 Species:Homo sapiens


Alignment Length:212 Identity:54/212 - (25%)
Similarity:74/212 - (34%) Gaps:78/212 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 RKLLGMPDSEPSPTEEEAR-----STASDHSASGNQSDGSENSQGRMVRVRRQSME----QLDLI 443
            ||:.|:...:.|..|:..|     .....||:..|        .||....|..|:|    ::.|:
Human    47 RKVTGVQGHDGSGGEDGGRLRPLCRAPRPHSSGPN--------LGRRDTHRSLSLEAVPREVALL 103

  Fly   444 KITPD-----GKR----MQEEKLRAQATRKAKDDD---FFEMLSRSQSKRMDDQRCSIKVNPAGA 496
            ...|.     ||.    .:....|..|...|...|   ||.:||..|..||:.||||::..|   
Human   104 ARAPGAGAGIGKETHVSFRTALQRGSAGTMAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGP--- 165

  Fly   497 PAVATGATRKPLVQQNSLFVDPTNLPGLKSPSSANPSAIGHGPLARSATTTQQPD-DDFLDMLMR 560
                 |.|.|   .|:    |||                              |: |..:|||..
Human   166 -----GQTTK---SQS----DPT------------------------------PEMDSLMDMLAS 188

  Fly   561 CQGSRLEEQR---SELP 574
            .||.|:::||   |.||
Human   189 TQGRRMDDQRVTVSSLP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pinsNP_524999.2 TPR_12 78..153 CDD:290160
TPR 83..114 CDD:197478
TPR repeat 83..109 CDD:276809
TPR repeat 120..150 CDD:276809
TPR_12 121..203 CDD:290160
TPR_12 162..250 CDD:290160
TPR repeat 162..199 CDD:276809
TPR 219..251 CDD:197478
TPR repeat 219..246 CDD:276809
TPR repeat 251..291 CDD:276809
TPR_12 259..330 CDD:290160
TPR repeat 296..326 CDD:276809
TPR_12 298..370 CDD:290160
TPR 298..330 CDD:197478
TPR repeat 338..366 CDD:276809
GoLoco 468..488 CDD:280368 10/22 (45%)
GoLoco 552..573 CDD:280368 10/23 (43%)
GoLoco 613..633 CDD:280368
PCP2XP_016881738.1 GoLoco 140..161 CDD:308026 10/20 (50%)
GoLoco 179..201 CDD:214645 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.