DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment larp and LARP6c

DIOPT Version :9

Sequence 1:NP_001247347.1 Gene:larp / 53567 FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001325674.1 Gene:LARP6c / 821444 AraportID:AT3G19090 Length:482 Species:Arabidopsis thaliana


Alignment Length:209 Identity:59/209 - (28%)
Similarity:86/209 - (41%) Gaps:55/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   631 GAAGG-AGAAGTGVGSATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGEYANYLP 694
            |..|| .|..|||||:.:..     ..|.||            |.||        |..::.:   
plant    75 GCGGGVCGGGGTGVGTQSSD-----WIYVGG------------GDPT--------AQHQHVH--- 111

  Fly   695 ADAAGADSQSSYVLMGTHYFGNVPAAYIELDANS-----------IKEAIKKQVEYYFSVDNLTG 748
             |.|.|           .|..| ||.......||           ::..|.|||||.|:..:|..
plant   112 -DPAAA-----------FYISN-PAVQFPASQNSSSSSKNLLSDDLRLKIVKQVEYQFTDMSLLA 163

  Fly   749 DFFLRRKM--DPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFEGYKVRTKTTPTTWP 811
            :..:.:.:  |||||:||:.|||..::.|||::..::..|::.|.||.:.|..|...:|:..|..
plant   164 NESISKHISKDPEGYVPVSYIASTKKIKALTSNHHLVSLALRSSSKLVVSEDGKKVKRTSQFTDR 228

  Fly   812 ITEVPEVNEGEPKA 825
            ..|..:||....||
plant   229 DREELQVNLNITKA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 27/74 (36%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LARP6cNP_001325674.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.