DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment larp and SSB

DIOPT Version :9

Sequence 1:NP_001247347.1 Gene:larp / 53567 FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001281074.1 Gene:SSB / 6741 HGNCID:11316 Length:408 Species:Homo sapiens


Alignment Length:376 Identity:81/376 - (21%)
Similarity:136/376 - (36%) Gaps:107/376 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   728 SIKEAIKKQVEYYFSVDNLTGDFFLRR--KMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKES 790
            :::..|..|:||||...||..|.||:.  |:| ||::|:.::..|:|:..||||..|||.|:.:|
Human    12 ALEAKICHQIEYYFGDFNLPRDKFLKEQIKLD-EGWVPLEIMIKFNRLNRLTTDFNVIVEALSKS 75

  Fly   791 DKLELFEGYKVRTKTTPTTWPITEVPEV-----NEGEPKAI--------GTLEQEQLEQNDGQEK 842
             |.||.|..:.:||...:  |...:|||     |:.:.:::        .||:       |.:|.
Human    76 -KAELMEISEDKTKIRRS--PSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLD-------DIKEW 130

  Fly   843 LEEQTEA--------------DSPPPILTSAMATKPLNSIP------------------PPPMPR 875
            ||::.:.              .|...:..|..:.|.....|                  ......
Human   131 LEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEE 195

  Fly   876 NPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLS---------------- 924
            ..||.|...|:.||:..:.  ..|.....:.:|.::: |...:.:|.|.                
Human   196 RKQNKVEAKLRAKQEQEAK--QKLEEDAEMKSLEEKI-GCLLKFSGDLDDQTCREDLHILFSNHG 257

  Fly   925 ---------GLAESV---KPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAIK 977
                     |..|.:   |.|:.....|...|:.||      ..:...|..|:.::...:..|:|
Human   258 EIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGN------LQLRNKEVTWEVLEGEVEKEALK 316

  Fly   978 ENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATV 1028
            :..    :.||..|::.        |:.....|.|...|.|....|....|
Human   317 KII----EDQQESLNKW--------KSKGRRFKGKGKGNKAAQPGSGKGKV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 31/74 (42%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
SSBNP_001281074.1 LARP_3 10..91 CDD:153397 33/80 (41%)
RRM1_La 112..183 CDD:240737 10/77 (13%)
RRM_3 231..334 CDD:370115 19/120 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..408 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.