DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment larp and ssb

DIOPT Version :9

Sequence 1:NP_001247347.1 Gene:larp / 53567 FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_955841.1 Gene:ssb / 321504 ZFINID:ZDB-GENE-030131-223 Length:401 Species:Danio rerio


Alignment Length:97 Identity:30/97 - (30%)
Similarity:58/97 - (59%) Gaps:4/97 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 DANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMD-PEGYIPVTLIASFHRVLALTTDVAVIVNAIK 788
            :.:.:::.:.:|:||||...||..|.||:.::. .:|::|:..:..|:|:.:||::.:|||.::.
Zfish     6 EMSPLEKKVAEQIEYYFGDHNLPRDKFLKEQLQLDDGWVPLETMLKFNRLKSLTSEESVIVESLL 70

  Fly   789 ESDKLELFEGYKVRTKTTPTTWPITEVPEVNE 820
            :| |..|.|..:.:||....  |...:||.||
Zfish    71 KS-KTGLLEISEDKTKIRRD--PNKPLPENNE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 23/73 (32%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
ssbNP_955841.1 LARP_3 7..88 CDD:153397 25/81 (31%)
RRM1_La 109..181 CDD:240737
RRM_3 229..326 CDD:285930
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.