DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and GUT1

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_011831.1 Gene:GUT1 / 856353 SGDID:S000001024 Length:709 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:40/155 - (25%)
Similarity:63/155 - (40%) Gaps:36/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HLEKLTHSSALIGTNLCL-SFLATMTTTCSDRQLLRGGKQKTTTCVGMTVMAKTTFEEICENAKL 69
            |.:||     |:....|| |.|.::.|..|:| :..|.......|:|:..|.:||   |..:.:.
Yeast   156 HPQKL-----LVNVVQCLASSLLSLQTINSER-VANGLPPYKVICMGIANMRETT---ILWSRRT 211

  Fly    70 ARDMALTGNYDSACIYYEGLQGLLARQLKATADPLRKGKWSMINQQISQEHAKIKAIQRTLQDIS 134
            .:.:.   ||        |:.....|.:|...|     ||.  |..:.::   ::..|:|    .
Yeast   212 GKPIV---NY--------GIVWNDTRTIKIVRD-----KWQ--NTSVDRQ---LQLRQKT----G 251

  Fly   135 LDLQSTKFA-HKLRHQLSEESTTSK 158
            |.|.||.|: .|||..|..|...:|
Yeast   252 LPLLSTYFSCSKLRWFLDNEPLCTK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359
AAA 358..496 CDD:214640
AAA 362..495 CDD:278434
Vps4_C <570..603 CDD:286426
GUT1NP_011831.1 NBD_sugar-kinase_HSP70_actin 46..685 CDD:418402 40/155 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.