DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and MPA43

DIOPT Version :10

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_014150.1 Gene:MPA43 / 855472 SGDID:S000005193 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:24/128 - (18%)
Similarity:37/128 - (28%) Gaps:63/128 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 FPWDIDEALRRRLEKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVC 539
            :.|:|:..|                |||     ||..:..|         .|:.|:|.:...|: 
Yeast   180 YEWNIEGLL----------------GRE-----NLNGIGND---------GEVSGWSSSFYKNI- 213

  Fly   540 REASMMSMRRKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMSRCNKSVS----RADLDKYEKW 598
                                       ::|| ||..........||.:|    |:.:|.|..|
Yeast   214 ---------------------------INLP-SNVSIGTTSLVANKHISTTVVRSCIDSYASW 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 Kp60-NTD 62..129 CDD:439297
PHA03291 <167..>253 CDD:223033
SpoVK 219..566 CDD:440232 13/90 (14%)
RecA-like_KTNA1 327..493 CDD:410930 3/17 (18%)
Vps4_C <570..603 CDD:462762 10/33 (30%)
MPA43NP_014150.1 ASKHA_ATPase-like 7..521 CDD:483947 24/128 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.