DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and RPT6

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_011467.1 Gene:RPT6 / 852834 SGDID:S000003016 Length:405 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:112/296 - (37%)
Similarity:166/296 - (56%) Gaps:32/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 ERKFQPNNHIEAELVDILERDILQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYFK--GIRR 357
            |.|..|       ||.::   :::|.|...:..:..|....:.::|.:.||:..|:.|:  ||.:
Yeast   127 ENKADP-------LVSLM---MVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQ 181

  Fly   358 PWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTI 422
            | |||::.||||||||:||:|||......|..||.|.|..||.||..:|||.||.|||.:|||.|
Yeast   182 P-KGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSII 245

  Fly   423 FIDEIDSLCSRR-----GSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEA 482
            |:|||||:.|.|     |.:||   .:|...|||.|:||.    |.:|.:.::.|||....:|.|
Yeast   246 FMDEIDSIGSTRVEGSGGGDSE---VQRTMLELLNQLDGF----ETSKNIKIIMATNRLDILDPA 303

  Fly   483 LRR--RLEKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMM 545
            |.|  |::::|..|.||...|..:|:|:.|::.:...::|..||.::.|.||||:..||.||.|.
Yeast   304 LLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMY 368

  Fly   546 SMRRKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMS 581
            ::|.:...:|.|.. :||..:    |.||:...|:|
Yeast   369 ALRERRIHVTQEDF-ELAVGK----VMNKNQETAIS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 24/57 (42%)
AAA 358..496 CDD:214640 68/144 (47%)
AAA 362..495 CDD:278434 64/139 (46%)
Vps4_C <570..603 CDD:286426 5/12 (42%)
RPT6NP_011467.1 RPT1 12..403 CDD:224143 112/296 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.