DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and RPT2

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_010277.1 Gene:RPT2 / 851557 SGDID:S000002165 Length:437 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:96/290 - (33%)
Similarity:156/290 - (53%) Gaps:29/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 NHIEAELVDILERDI--------LQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYFK--GIR 356
            :|....:|.:|:.|.        :.|.|...:|||..|....:.::|:|.||:..|:.::  ||:
Yeast   150 HHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIK 214

  Fly   357 RPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPST 421
            .| |||::.|.||||||:||||||.:...||..:..:.|..||.|:..::.|.:|::|...|||.
Yeast   215 PP-KGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSI 278

  Fly   422 IFIDEIDSLCSRR-----GSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDE 481
            :||||||::.::|     |.|.|   .:|...|||.|:||.    :....|.|:.|||....:|.
Yeast   279 VFIDEIDAIGTKRYDSNSGGERE---IQRTMLELLNQLDGF----DDRGDVKVIMATNKIETLDP 336

  Fly   482 ALRR--RLEKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASM 544
            ||.|  |::::|....|....::.:|.|:..::.:.:.|:|..:.......|||||..:|.||.:
Yeast   337 ALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGL 401

  Fly   545 MSMRRKIAGLTPEQIRQLATEEVDLPVSNK 574
            :::|.:...:|.|..:| |.|.|   :.||
Yeast   402 LALRERRMQVTAEDFKQ-AKERV---MKNK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 27/57 (47%)
AAA 358..496 CDD:214640 57/144 (40%)
AAA 362..495 CDD:278434 54/139 (39%)
Vps4_C <570..603 CDD:286426 2/5 (40%)
RPT2NP_010277.1 PTZ00361 1..437 CDD:185575 96/290 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.