DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and AT1G05910

DIOPT Version :10

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_563753.1 Gene:AT1G05910 / 837101 AraportID:AT1G05910 Length:1210 Species:Arabidopsis thaliana


Alignment Length:84 Identity:17/84 - (20%)
Similarity:30/84 - (35%) Gaps:21/84 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 KEDFYNIRDILTSRSSFQEAKF--------QFPRIELHQIS----------ELFNLGTYQKEEFE 425
            ||:.|...   ...||.||.:.        :.|.:::|...          :||.|..:.:|..|
plant    46 KEEKYKCS---AQPSSSQEQRLIHTEDQTQKVPVLDIHSSKDVPRSGKMKLQLFPLDAHTREGLE 107

  Fly   426 YPGIETFYNHEFNGRFRVS 444
            ..|...:.....:.|.::|
plant   108 KDGFHPYLELTLSSRKKIS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 Kp60-NTD 62..129 CDD:439297
PHA03291 <167..>253 CDD:223033
SpoVK 219..566 CDD:440232 17/84 (20%)
RecA-like_KTNA1 327..493 CDD:410930 17/84 (20%)
Vps4_C <570..603 CDD:462762
AT1G05910NP_563753.1 SpoVK 258..617 CDD:440232
P-loop containing Nucleoside Triphosphate Hydrolases 382..551 CDD:476819
Bromo_AAA 895..1005 CDD:99957
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.