DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and Gk

DIOPT Version :10

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:XP_008771496.1 Gene:Gk / 79223 RGDID:70893 Length:587 Species:Rattus norvegicus


Alignment Length:43 Identity:12/43 - (27%)
Similarity:21/43 - (48%) Gaps:4/43 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 KFQPNNHIEAELVDILERDILQKDPKVRWSDIADLHDAKRLLE 339
            :|...|...|||:...:.:|.|:.|:..|.:    .|.|.:|:
  Rat    24 RFLVFNSKTAELLSHHQVEIKQEFPREGWVE----QDPKEILQ 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 Kp60-NTD 62..129 CDD:439297
PHA03291 <167..>253 CDD:223033
SpoVK 219..566 CDD:440232 12/43 (28%)
RecA-like_KTNA1 327..493 CDD:410930 3/13 (23%)
Vps4_C <570..603 CDD:462762
GkXP_008771496.1 ASKHA_NBD_FGGY_GK1-3-like 11..544 CDD:466802 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.