DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and PSMC5

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:XP_024306608.1 Gene:PSMC5 / 5705 HGNCID:9552 Length:433 Species:Homo sapiens


Alignment Length:293 Identity:111/293 - (37%)
Similarity:163/293 - (55%) Gaps:25/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 KFQPNNHIEAELVD-ILERDILQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYFK--GIRRP 358
            |..||.      || ::...:::|.|...:..|..|....:.::|.:.||:..|:.|:  ||.:|
Human   152 KILPNK------VDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQP 210

  Fly   359 WKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTIF 423
             ||||:.||||||||:||:|||.....||..||.:.|..|:.||..:|||.||.|||.:|||.||
Human   211 -KGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIF 274

  Fly   424 IDEIDSLCSRR---GSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEALRR 485
            :|||||:.|.|   ||..:.|. :|...|||.|:||.    |..|.:.|:.|||....:|.||.|
Human   275 MDEIDSIGSSRLEGGSGGDSEV-QRTMLELLNQLDGF----EATKNIKVIMATNRIDILDSALLR 334

  Fly   486 --RLEKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMSMR 548
              |::::|..|.|::|.|..:|||:.|::.:...::|..:|..:.|.|||::..||.||.|.::|
Human   335 PGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALR 399

  Fly   549 RKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMS 581
            .:...:|.|.......:     |..||..:.||
Human   400 ERRVHVTQEDFEMAVAK-----VMQKDSEKNMS 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 26/57 (46%)
AAA 358..496 CDD:214640 69/142 (49%)
AAA 362..495 CDD:278434 65/137 (47%)
Vps4_C <570..603 CDD:286426 5/12 (42%)
PSMC5XP_024306608.1 RPT1 4..431 CDD:224143 111/293 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.