DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and psmc5

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001003740.1 Gene:psmc5 / 445285 ZFINID:ZDB-GENE-030131-6547 Length:406 Species:Danio rerio


Alignment Length:293 Identity:111/293 - (37%)
Similarity:163/293 - (55%) Gaps:25/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 KFQPNNHIEAELVD-ILERDILQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYFK--GIRRP 358
            |..||.      || ::...:::|.|...:..|..|....:.::|.:.||:..|:.|:  ||.:|
Zfish   125 KILPNK------VDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQP 183

  Fly   359 WKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTIF 423
             ||||:.||||||||:||:|||.....||..||.:.|..|:.||..:|||.||.|||.:|||.||
Zfish   184 -KGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIF 247

  Fly   424 IDEIDSLCSRR---GSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEALRR 485
            :|||||:.|.|   ||..:.|. :|...|||.|:||.    |..|.:.|:.|||....:|.||.|
Zfish   248 MDEIDSIGSSRLEGGSGGDSEV-QRTMLELLNQLDGF----EATKNIKVIMATNRIDILDSALLR 307

  Fly   486 --RLEKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMSMR 548
              |::::|..|.|::|.|..:|||:.|::.:...::|..:|..:.|.|||::..||.||.|.::|
Zfish   308 PGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALR 372

  Fly   549 RKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMS 581
            .:...:|.|.......:     |..||..:.||
Zfish   373 ERRVHVTQEDFEMAVAK-----VMQKDSEKNMS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 26/57 (46%)
AAA 358..496 CDD:214640 69/142 (49%)
AAA 362..495 CDD:278434 65/137 (47%)
Vps4_C <570..603 CDD:286426 5/12 (42%)
psmc5NP_001003740.1 RPT1 4..404 CDD:224143 111/293 (38%)
AAA_16 153..>206 CDD:289934 26/53 (49%)
AAA 186..318 CDD:278434 65/136 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.