DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and nmd

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster


Alignment Length:305 Identity:110/305 - (36%)
Similarity:166/305 - (54%) Gaps:27/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 AQEEERKFQPNNHIEAELVDILERDILQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYFKGI 355
            |::|..|.:.....:.||: |....::..|..|.|:|||.|....:.|.|:||||:...|.||. 
  Fly    63 AEQEGFKLRGQEFSDYELM-IASHLVVPADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKH- 125

  Fly   356 RRPW---KGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFY 417
            .:.|   ||||:.||||.|||::|||.|.|.|..|.|:..|.||.|:.|||:|:...:|.:|...
  Fly   126 SKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRI 190

  Fly   418 APSTIFIDEIDSLCSRRGSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEA 482
            .|..||||||||....| :.::|||:..:|::.::..||:.....  ..|:|:.|||.|.|:|:|
  Fly   191 EPCIIFIDEIDSFLRSR-NMNDHEATAMMKTQFMMLWDGLSTNAN--STVIVMGATNRPQDLDKA 252

  Fly   483 LRRRLEKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMSM 547
            :.||:..:.:|.|||:..|:.:||:.|:..:|...|||..::....|:||:|:..:||.||:..|
  Fly   253 IVRRMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRM 317

  Fly   548 RRKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMSRCNKSVSRADL 592
            |:.|....|.     ||              |:.|.|..::..||
  Fly   318 RQLITSRDPS-----AT--------------ALDRNNVRITMDDL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 29/58 (50%)
AAA 358..496 CDD:214640 58/140 (41%)
AAA 362..495 CDD:278434 55/132 (42%)
Vps4_C <570..603 CDD:286426 5/23 (22%)
nmdNP_001285801.1 AAA 132..266 CDD:214640 57/136 (42%)
AAA 135..265 CDD:278434 55/132 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.