DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and CG1271

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster


Alignment Length:248 Identity:44/248 - (17%)
Similarity:89/248 - (35%) Gaps:74/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 GPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTIFIDEIDSL 430
            |||.:...:||..|.|.|..:|.                                      :|..
  Fly    25 GPPDSPAFILALDVGTTCVRSFV--------------------------------------LDEQ 51

  Fly   431 CSRRGSESEHEASRRVKSELLVQMDGVGGGEEQA---KVVMVLA-----ATNFPWDIDEALRRRL 487
            |..|||..:       ..|||....|....|.::   |:|.|:.     |...|.|| ..|....
  Fly    52 CEVRGSAVD-------AVELLNPQPGYFEIEPESLWRKIVGVITQAVKNAQLTPPDI-TCLTIST 108

  Fly   488 EKRIYIPLPSDEGREALLKINLREVKVDDSVD---LTYVANELKGYSGADITNVCREASMM--SM 547
            ::..::......|......|..::::.|:.||   .::..:.:..:|.| :..:.|::..:  |:
  Fly   109 QRCTFLTWDHRSGEYYHNFITWKDLRADELVDQWNASWTKSSMNWFSYA-LFLLTRQSRFLAGSV 172

  Fly   548 RRKIAG-LTPEQIRQLATEEVDLPVSNKDFNEAMSRCNKSVSRADLDKYEKWM 599
            .:.:.| :||..:.::        ::||...:|:.:     .:|.::..:.|:
  Fly   173 LQLMNGQVTPRLLFEI--------MNNKKLKQALMQ-----KKARVELLDSWI 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 6/14 (43%)
AAA 358..496 CDD:214640 27/137 (20%)
AAA 362..495 CDD:278434 27/136 (20%)
Vps4_C <570..603 CDD:286426 5/30 (17%)
CG1271NP_647763.1 GlpK 32..555 CDD:223628 41/241 (17%)
FGGY_GK5_metazoa 32..552 CDD:212665 41/241 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.