DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and CG4701

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_609721.1 Gene:CG4701 / 34858 FlyBaseID:FBgn0028868 Length:384 Species:Drosophila melanogaster


Alignment Length:257 Identity:100/257 - (38%)
Similarity:153/257 - (59%) Gaps:8/257 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 RKFQPNNHIEAELVDILERDILQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYF---KGIRR 357
            :||:..:..|.|:: |....:..:|..:.|||||.|....:.|.|.||||:.....|   |..|.
  Fly    66 KKFRARDFNEHEMM-IASHLVTPEDIDISWSDIAGLDGTIQELRETVVLPVRHRKLFSRSKLWRA 129

  Fly   358 PWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTI 422
            | ||||:.||||.|||::|||:|.:.|..|.|:....||.|:.|||:|:...:|.:|:...|..|
  Fly   130 P-KGVLLHGPPGCGKTLIAKAIAKDAGMRFINLDVGVLTDKWYGESQKLATAVFTLAKKLQPCII 193

  Fly   423 FIDEIDSLCSRRGSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEALRRRL 487
            |||||:|....||| ::|||:..:|::.::|.||:.......  |:||.|||.|.|:|:|:.||:
  Fly   194 FIDEIESFLRMRGS-NDHEATAMIKTQFMLQWDGLMSNTNIC--VLVLGATNRPQDLDKAILRRM 255

  Fly   488 EKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMSMRR 549
            ..:.:|.:|.|..|..:|::.|:..::..||:|..:|....|:||:|:..:||.|||..||:
  Fly   256 PAQFHIGVPRDCQRREILQLILQTEQLSPSVNLKELARLTIGFSGSDLRELCRHASMYRMRQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 30/58 (52%)
AAA 358..496 CDD:214640 59/137 (43%)
AAA 362..495 CDD:278434 56/132 (42%)
Vps4_C <570..603 CDD:286426
CG4701NP_609721.1 Parvo_NS1 47..>152 CDD:305166 36/87 (41%)
AAA 130..265 CDD:214640 59/138 (43%)
AAA 133..265 CDD:278434 56/134 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.