DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and Atad1

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001030174.1 Gene:Atad1 / 309532 RGDID:1308570 Length:361 Species:Rattus norvegicus


Alignment Length:323 Identity:119/323 - (36%)
Similarity:174/323 - (53%) Gaps:33/323 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 DPQAAQEEERKFQPNN-----------------HIEAELVDILERDILQKDPKVRWSDIADLHDA 334
            ||...|:.|.:.|...                 .|.|.|||.|       :..|.|||||.|.|.
  Rat    42 DPTRKQKVEAQKQAEKLMKQIGVKNVKLSEYEMSIAAHLVDPL-------NMHVTWSDIAGLDDV 99

  Fly   335 KRLLEEAVVLPMLMPDYFKGIR--RPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTS 397
            ...|::.|:||:.....|:..|  :|.||||:.||||.|||::|||.|.|.|..|.|:..:|||.
  Rat   100 ITDLKDTVILPIKKKHLFENSRLLQPPKGVLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLTD 164

  Fly   398 KYRGESEKMVRLLFEMARFYAPSTIFIDEIDSLCSRRGSESEHEASRRVKSELLVQMDGVGGGEE 462
            |:.|||:|:...:|.:|....||.||||||||....| |.|:|||:..:|::.:...||:  ..:
  Rat   165 KWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNR-SSSDHEATAMMKAQFMSLWDGL--DTD 226

  Fly   463 QAKVVMVLAATNFPWDIDEALRRRLEKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANEL 527
            .:..|:|:.|||.|.|:|.|:.||:..|.:|..|:.:.|||:||:.|:...||..|||..||.|.
  Rat   227 HSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQET 291

  Fly   528 KGYSGADITNVCREASMMSMRRKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMSRCNKSVSRA 590
            .|:||:|:..:||:|:::.:|..:...:.|.    ..|:...||..:|.:.|:.:..||...|
  Rat   292 DGFSGSDLKEMCRDAALLCVREYVNSTSEES----HDEDEIRPVQQQDLHRAIEKMKKSKDAA 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 28/57 (49%)
AAA 358..496 CDD:214640 62/137 (45%)
AAA 362..495 CDD:278434 59/132 (45%)
Vps4_C <570..603 CDD:286426 7/21 (33%)
Atad1NP_001030174.1 RecA-like_ATAD1 92..257 CDD:410928 72/167 (43%)
AAA_lid_3 282..321 CDD:407720 14/38 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.