powered by:
Protein Alignment Kat60 and GK2
DIOPT Version :9
Sequence 1: | NP_001262276.1 |
Gene: | Kat60 / 53566 |
FlyBaseID: | FBgn0040208 |
Length: | 605 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_149991.2 |
Gene: | GK2 / 2712 |
HGNCID: | 4291 |
Length: | 553 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 18/70 - (25%) |
Similarity: | 28/70 - (40%) |
Gaps: | 13/70 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 270 STAAGNNGGAAGDGENGDPQAAQEEERKFQPNNHIEAELVDILERDILQKDPKVRWSDIADLHDA 334
:.|.|...||...|.| ..:|...|...|||:...:.::.|:.||..|.: .|.
Human 6 TAAVGPLVGAVVQGTN---------STRFLVFNSKTAELLSHHKVELTQEFPKEGWVE----QDP 57
Fly 335 KRLLE 339
|.:|:
Human 58 KEILQ 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0554 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.