DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and GK2

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_149991.2 Gene:GK2 / 2712 HGNCID:4291 Length:553 Species:Homo sapiens


Alignment Length:70 Identity:18/70 - (25%)
Similarity:28/70 - (40%) Gaps:13/70 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 STAAGNNGGAAGDGENGDPQAAQEEERKFQPNNHIEAELVDILERDILQKDPKVRWSDIADLHDA 334
            :.|.|...||...|.|         ..:|...|...|||:...:.::.|:.||..|.:    .|.
Human     6 TAAVGPLVGAVVQGTN---------STRFLVFNSKTAELLSHHKVELTQEFPKEGWVE----QDP 57

  Fly   335 KRLLE 339
            |.:|:
Human    58 KEILQ 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 4/15 (27%)
AAA 358..496 CDD:214640
AAA 362..495 CDD:278434
Vps4_C <570..603 CDD:286426
GK2NP_149991.2 FGGY_GK1-3_metazoa 11..513 CDD:212664 16/65 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.