DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kat60 and GK

DIOPT Version :9

Sequence 1:	NP_001262276.1	Gene:	Kat60 / 53566	FlyBaseID:	FBgn0040208	Length:	605	Species:	Drosophila melanogaster
Sequence 2:	XP_011543793.1	Gene:	GK / 2710	HGNCID:	4289	Length:	587	Species:	Homo sapiens

Alignment Length:	144	Identity:	31/144 - (21%)
Similarity:	53/144 - (36%)	Gaps:	45/144 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   112 INQQISQE-----------HAKIKAIQRT---LQDISLDLQSTKFAHKLRHQLSEESTTSKDP-- 160
            |.|:..:|           |:..:.|::|   |..:::|:.:.| |..:.:|  .|:|...|.
Human    43 IKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIK-AIGVSNQ--RETTVVWDKIT 104

  Fly   161 --------SAWFKPDPDI---------WTPPPKDPDVWGPPKPPPTTQAVGRRAAPNNRRTTPAT 208
                    :|...|.|.:         ..|.|....||...:...|.:::.:|...||
Human   105 GEPLYNAVAAPVSPGPSVPVAVVPSGSSVPAPGTSSVWLDLRTQSTVESLSKRIPGNN------- 162

  Fly   209 QNSRPSST-IPQST 221
             |...|.| :|.||
Human   163 -NFVKSKTGLPLST 175

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kat60	NP_001262276.1	HCV_NS5a_C	<163..243	CDD:289693	16/69 (23%)
		P-loop_NTPase	325..>381	CDD:304359
		AAA	358..496	CDD:214640
		AAA	362..495	CDD:278434
		Vps4_C	<570..603	CDD:286426
GK	XP_011543793.1	FGGY_GK1-3_metazoa	11..547	CDD:212664	31/144 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0554
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900