DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and Psmc2

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001355590.1 Gene:Psmc2 / 19181 MGIID:109555 Length:433 Species:Mus musculus


Alignment Length:280 Identity:104/280 - (37%)
Similarity:150/280 - (53%) Gaps:30/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 LQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYF--KGIRRPWKGVLMVGPPGTGKTMLAKAV 379
            :::.|.|.:||:....:....|.|.|..|:|.|:.|  .||..| ||||:.||||||||:.|:||
Mouse   166 VEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPP-KGVLLFGPPGTGKTLCARAV 229

  Fly   380 ATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTIFIDEIDSLCSRR---GSESEHE 441
            |......|..|..:.|..||.||..:|||.||||||......||.||||::...|   |:..::|
Mouse   230 ANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNE 294

  Fly   442 ASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEALRR--RLEKRIYIPLPSDEGREAL 504
            . :|...||:.|:||.    :....:.||.|||.|..:|.||.|  ||:::|...||..|||..:
Mouse   295 V-QRTMLELINQLDGF----DPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHI 354

  Fly   505 LKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMSMRRKIAGLTPEQIRQLATEEVDL 569
            .||:.|.:.|:..:....:|......:||:|.:||.||.|.::|.:         |::|||    
Mouse   355 FKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRAR---------RKIATE---- 406

  Fly   570 PVSNKDFNEAMSRCNKSVSR 589
                |||.||:::..||.::
Mouse   407 ----KDFLEAVNKVIKSYAK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 27/57 (47%)
AAA 358..496 CDD:214640 61/142 (43%)
AAA 362..495 CDD:278434 58/137 (42%)
Vps4_C <570..603 CDD:286426 7/20 (35%)
Psmc2NP_001355590.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
RPT1 23..430 CDD:224143 104/280 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.