DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and Gk2

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_034424.1 Gene:Gk2 / 14626 MGIID:1329027 Length:554 Species:Mus musculus


Alignment Length:285 Identity:52/285 - (18%)
Similarity:82/285 - (28%) Gaps:102/285 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 TAAGNNGGAAGDGENGDPQAAQEEERKFQPNNHIEAELVDILERDILQKDPKVRWSDIADLHDAK 335
            |:||...||...|.|         ..:|...|...||||...:.::.|:.||..|.:    .|.|
Mouse     7 TSAGPLVGAVVQGTN---------STRFLVFNSKTAELVCSHQVELTQEYPKEGWVE----QDPK 58

  Fly   336 RLLEEAVVLPMLMPDYFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNV---------- 390
            .:|:..........:....:......:..:|.....:|.:.....|  |...:|.          
Mouse    59 EILKSVYECIAKACEKLAEVNIDISNIKAIGVSNQRETTVVWDKFT--GDPLYNAVVWLDLRTQS 121

  Fly   391 SSATLTSKYRGESEKMVRLLFEMARFYAP-STIFIDEIDSLCSRRGSESEHEASRRVKSELLVQM 454
            :..|||.|..|.|.      |..::...| ||.|                               
Mouse   122 TVETLTKKIPGNSN------FVKSKTGLPLSTYF------------------------------- 149

  Fly   455 DGVGGGEEQAKVVMVLAATNFPWDIDEALRRRLEKRIYIPLPSDEGREALLKINLREVKVDDSVD 519
                            :|....|.:|..  |.::|.:      :|||...           .::|
Mouse   150 ----------------SAVKLRWMLDNL--RPIQKAV------EEGRAMF-----------GTID 179

  Fly   520 LTYVANELKGYSG----ADITNVCR 540
            ...:.....|.:|    .|:||.||
Mouse   180 SWLIWCMTGGVNGGIHCTDVTNACR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 6/55 (11%)
AAA 358..496 CDD:214640 21/148 (14%)
AAA 362..495 CDD:278434 21/143 (15%)
Vps4_C <570..603 CDD:286426
Gk2NP_034424.1 glycerol_kin 11..513 CDD:273549 49/281 (17%)
FGGY_GK1-3_metazoa 11..513 CDD:212664 49/281 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.