DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and Gykl1

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_034423.2 Gene:Gykl1 / 14625 MGIID:891990 Length:549 Species:Mus musculus


Alignment Length:117 Identity:27/117 - (23%)
Similarity:46/117 - (39%) Gaps:32/117 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSALIGTNLCLSFLATMTTTCSDRQLLRGGKQKTTTCVGMTVMAKTTFEEICENAKLARDMALTG 77
            |:||:| .||                |:.|:.|:|...|..::..|  .:.|.|::  ..:..|.
Mouse   261 SAALVG-QLC----------------LQDGQAKSTYGTGCFLLCNT--GQKCVNSE--HGLLTTV 304

  Fly    78 NYD---SACIYYEGLQGLLARQLKATADPLRKGKWSMINQQISQEHAKIKAI 126
            .|.   ...:|| .|:|.:|......:       |...|.||.|..::|:.:
Mouse   305 AYQLGRQEPVYY-ALEGSVAIAGAVVS-------WIKNNLQIIQSSSEIEKL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359
AAA 358..496 CDD:214640
AAA 362..495 CDD:278434
Vps4_C <570..603 CDD:286426
Gykl1NP_034423.2 glycerol_kin 11..513 CDD:273549 27/117 (23%)
FGGY_GK1-3_metazoa 11..513 CDD:212664 27/117 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.