DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kat60 and Vps4a

DIOPT Version :9

Sequence 1:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_569053.1 Gene:Vps4a / 116733 MGIID:1890520 Length:437 Species:Mus musculus


Alignment Length:395 Identity:149/395 - (37%)
Similarity:215/395 - (54%) Gaps:76/395 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 NGRAGGRKLSTSNTNEARDDDSTAAGNNGGAAGDGENGDPQAAQEEERKFQPNNHIEAELVDILE 313
            |....|:|....|.:|.:..||.:.|:|                .|::|.|          :.|.
Mouse    76 NKEKHGKKPVKENQSEGKGSDSDSEGDN----------------PEKKKLQ----------EQLM 114

  Fly   314 RDILQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYFKGIRRPWKGVLMVGPPGTGKTMLAKA 378
            ..::.:.|.:||:|:|.|..||..|:|||:||:..|..|.|.|.||:|:|:.|||||||:.||||
Mouse   115 GAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKA 179

  Fly   379 VATEC-GTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTIFIDEIDSLCSRRGSESEHEA 442
            ||||. .:|||:|||:.|.||:.|||||:|:.|||:||.:.||.|||||:||||..| :|:|.||
Mouse   180 VATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSR-NENESEA 243

  Fly   443 SRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEALRRRLEKRIYIPLPSDEGREALLKI 507
            :||:|:|.||||.|||...:.   .:||.|||.||.:|.|:|||.|||||||||.:..|..:.::
Mouse   244 ARRIKTEFLVQMQGVGNNNDG---TLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRL 305

  Fly   508 -------NLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMSMR--------RKIAG---- 553
                   ||.:..:.:      :|.:.:|||||||:.:.|::.|..:|        :|:.|    
Mouse   306 HLGSTPHNLTDANIHE------LARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRT 364

  Fly   554 ---------LTPEQIRQLATEE---VDLP--------VSNKDFNEAMSRCNKSVSRADLDKYEKW 598
                     |||.........|   :|:|        |...|...:::....:|:..||.|.:|:
Mouse   365 NPSVMIDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKF 429

  Fly   599 MREFG 603
            ..:||
Mouse   430 SEDFG 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 32/55 (58%)
AAA 358..496 CDD:214640 85/138 (62%)
AAA 362..495 CDD:278434 81/133 (61%)
Vps4_C <570..603 CDD:286426 8/40 (20%)
Vps4aNP_569053.1 PTZ00454 4..348 CDD:240423 131/307 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..106 9/45 (20%)
RecA-like_VPS4 121..291 CDD:410929 100/173 (58%)
Vps4_C 374..434 CDD:401324 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.