DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retinin and Tmem38a

DIOPT Version :9

Sequence 1:NP_524995.2 Gene:retinin / 53564 FlyBaseID:FBgn0040074 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_653117.1 Gene:Tmem38a / 74166 MGIID:1921416 Length:298 Species:Mus musculus


Alignment Length:61 Identity:15/61 - (24%)
Similarity:23/61 - (37%) Gaps:25/61 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FLPVLAIVL----------VSIGASHT-----------ASLEW--PSNLVALSSVKSSQLL 42
            ||||..|.:          :::|..|.           .:..|  .|.:..||:|:  |||
Mouse   111 FLPVKLIFVAMKEVVRVRKIAVGIHHAHHHYHHGWFIMIATGWVKGSGVALLSNVE--QLL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retininNP_524995.2 Retinin_C 122..>169 CDD:309599
Tmem38aNP_653117.1 TRIC 43..225 CDD:282982 15/61 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.