DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retinin and Tmem38a

DIOPT Version :10

Sequence 1:NP_524995.2 Gene:retinin / 53564 FlyBaseID:FBgn0040074 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_653117.1 Gene:Tmem38a / 74166 MGIID:1921416 Length:298 Species:Mus musculus


Alignment Length:100 Identity:27/100 - (27%)
Similarity:39/100 - (39%) Gaps:22/100 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GQSRLPQSQSSVDSKSYVLVSELPLEVFKKHVVDE-------TTSPVTGFTF---VVLAIVQLAG 145
            |||..|....|....|..|.::....||.:.|...       ||:.|..|||   |.|.::|.:.
Mouse   100 GQSNDPPEYDSDQFTSSGLDNKEIRRVFIRKVFSVLSLQLAITTAFVAIFTFEPHVKLFVMQNSW 164

  Fly   146 G--------KIPEGMLL-LGLLRRSFLWFRCNVLC 171
            .        .:|..::| .|..||...|   |::|
Mouse   165 TYWVGYLVFLVPYFVILCCGEFRRKHPW---NLIC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retininNP_524995.2 Retinin_C 122..>169 CDD:427994 16/65 (25%)
Tmem38aNP_653117.1 TRIC 43..226 CDD:461583 26/99 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..298
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.