DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retinin and TMEM38B

DIOPT Version :10

Sequence 1:NP_524995.2 Gene:retinin / 53564 FlyBaseID:FBgn0040074 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_060582.1 Gene:TMEM38B / 55151 HGNCID:25535 Length:291 Species:Homo sapiens


Alignment Length:77 Identity:16/77 - (20%)
Similarity:36/77 - (46%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFLPVLAIVL--VSIGASHTASLEWPSNLVALSSVKSSQLLPIASEDSVELADGSSGSVSSSAAQ 66
            :||..:.||.  :::..:.|:::.:......||.:......|.:|.:....|...|..|.|.|::
Human   209 MFLYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASK 273

  Fly    67 PEDQSQEEAEEQ 78
            |.|.:.:..:::
Human   274 PVDVASDNVKKK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retininNP_524995.2 Retinin_C 122..>169 CDD:427994
TMEM38BNP_060582.1 TRIC 39..221 CDD:461583 4/11 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..291 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.