DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retinin and CG13056

DIOPT Version :9

Sequence 1:NP_524995.2 Gene:retinin / 53564 FlyBaseID:FBgn0040074 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_652414.2 Gene:CG13056 / 50267 FlyBaseID:FBgn0040794 Length:99 Species:Drosophila melanogaster


Alignment Length:43 Identity:23/43 - (53%)
Similarity:31/43 - (72%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PAVAKVGEVVQHVPTAVSHQTQTVVHDHRRLVTPIVAPAVRTT 167
            |..||||.:|:|||||||||:.|:||......|.::.||:|:|
  Fly    36 PTFAKVGHLVEHVPTAVSHQSSTIVHRSVPRTTSLLTPALRST 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retininNP_524995.2 Retinin_C 122..>169 CDD:309599 23/43 (53%)
CG13056NP_652414.2 Retinin_C 34..>83 CDD:282395 23/43 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.